Styjun

Alignement of different align environment

Quick destruction of a helium filled airship?

Tikz: The position of a label change step-wise and not in a continuous way

Heyawacky: Ace of Cups

Get file name and directory in .vimrc file

How to use the passive form to say "This flower was watered."

Trying to understand how Digital Certificates and CA are indeed secure

What are the advantages of this gold finger shape?

If I am sleeping clutching on to something, how easy is it to steal that item?

How do I answer an interview question about how to handle a hard deadline I won't be able to meet?

How does the illumination of the sky from the sun compare to that of the moon?

Unsolved Problems due to Lack of Computational Power

What should I do if actually I found a serious flaw in someone's PhD thesis and an article derived from that PhD thesis?

What if a restaurant suddenly cannot accept credit cards, and the customer has no cash?

Unconventional examples of mathematical modelling

What allows us to use imaginary numbers?

Why do aircraft leave cruising altitude long before landing just to circle?

Is the Microsoft recommendation to use C# properties applicable to game development?

What was the intention with the Commodore 128?

Is a suspension needed to do wheelies?

Subgroup generated by a subgroup and a conjugate of it

How to prevent criminal gangs from making/buying guns?

programming a recursive formula into Mathematica and find the nth position in the sequence

Do I need to start off my book by describing the character's "normal world"?

Unable to import 'MySQLdb' pylint(import-error)

python sqlite failserror: Unable to find vcvarsall.batConnecting postgresql with sqlalchemyHow do I import an SQL file using the command line in MySQL?I used sqlite + pysqlite2 + sqlalchemy. But there are some confused error. eg.undefined symbolProper connection string to pass to sqlalchemy create_engine() for mysql AWS RDSTypeError: unsupported operand type(s) for *: 'int' and 'NoneType'sqlalchemy fails to connect to ms sql serversqlalchemy showing an error related to os.getenv()Error when accessing mysql database with sqlalchemy engine

.everyoneloves__top-leaderboard:empty,.everyoneloves__mid-leaderboard:empty,.everyoneloves__bot-mid-leaderboard:empty margin-bottom:0;

1

1

I am trying to set connection to data base as I have FTP IP,User,Password and FTP Link on file zilla in python using some libraries in pandas as I have an error in problems error

Unable to import 'MySQLdb'pylint(import-error)[2,1]

and this terminal error

During handling of the above exception, another exception occurred:

Traceback (most recent call last):
File "c:/Users/user 3/Desktop/My Python Refrence/ImpDataToMySQL.py", line 
8, in <module>
engine = create_engine('sqlite:///:memory:', echo=True)
File "C:Anacondalibsite-packagessqlalchemyengine__init__.py", line 
425, in create_engine
return strategy.create(*args, **kwargs)
File "C:Anacondalibsite-packagessqlalchemyenginestrategies.py", line 
81, in create
dbapi = dialect_cls.dbapi(**dbapi_args)
File "C:Anacondalibsite- 
packagessqlalchemydialectssqlitepysqlite.py", line 339, in dbapi
raise e
File "C:Anacondalibsite- 
packagessqlalchemydialectssqlitepysqlite.py", line 337, in dbapi
from sqlite3 import dbapi2 as sqlite # try 2.5+ stdlib name.
File "C:Anacondalibsqlite3__init__.py", line 23, in <module>
from sqlite3.dbapi2 import *
File "C:Anacondalibsqlite3dbapi2.py", line 27, in <module>
from _sqlite3 import *
ImportError: DLL load failed: The specified module could not be found.

as I found the error in this line

engine = create_engine('sqlite:///:memory:', echo=True)

I noticed that there's a concept for using this engine connection but I don't know how

As I have Details for connection like this

FTP IP : 10.xx.xx.x
User : xxxxxxx
Password : xxxxxxxx
FTP link on file zilla : /export/home/omc/var/prs/result_file/

so I searched a solution for this case I think the solution in this document

https://docs.sqlalchemy.org/en/latest/core/connections.html

but it's complicated to understand this documentation so if any one could help me to solve this I'll be thankful

python mysql sqlalchemy ftp

share|improve this question

edited Mar 27 at 14:20

Martin Prikryl

100k2525 gold badges210210 silver badges437437 bronze badges

asked Mar 27 at 13:23

Dev.7arooneyDev.7arooney

8911 silver badge1111 bronze badges

add a comment | 

1

1

I am trying to set connection to data base as I have FTP IP,User,Password and FTP Link on file zilla in python using some libraries in pandas as I have an error in problems error

Unable to import 'MySQLdb'pylint(import-error)[2,1]

and this terminal error

During handling of the above exception, another exception occurred:

Traceback (most recent call last):
File "c:/Users/user 3/Desktop/My Python Refrence/ImpDataToMySQL.py", line 
8, in <module>
engine = create_engine('sqlite:///:memory:', echo=True)
File "C:Anacondalibsite-packagessqlalchemyengine__init__.py", line 
425, in create_engine
return strategy.create(*args, **kwargs)
File "C:Anacondalibsite-packagessqlalchemyenginestrategies.py", line 
81, in create
dbapi = dialect_cls.dbapi(**dbapi_args)
File "C:Anacondalibsite- 
packagessqlalchemydialectssqlitepysqlite.py", line 339, in dbapi
raise e
File "C:Anacondalibsite- 
packagessqlalchemydialectssqlitepysqlite.py", line 337, in dbapi
from sqlite3 import dbapi2 as sqlite # try 2.5+ stdlib name.
File "C:Anacondalibsqlite3__init__.py", line 23, in <module>
from sqlite3.dbapi2 import *
File "C:Anacondalibsqlite3dbapi2.py", line 27, in <module>
from _sqlite3 import *
ImportError: DLL load failed: The specified module could not be found.

as I found the error in this line

engine = create_engine('sqlite:///:memory:', echo=True)

I noticed that there's a concept for using this engine connection but I don't know how

As I have Details for connection like this

FTP IP : 10.xx.xx.x
User : xxxxxxx
Password : xxxxxxxx
FTP link on file zilla : /export/home/omc/var/prs/result_file/

so I searched a solution for this case I think the solution in this document

https://docs.sqlalchemy.org/en/latest/core/connections.html

but it's complicated to understand this documentation so if any one could help me to solve this I'll be thankful

python mysql sqlalchemy ftp

share|improve this question

edited Mar 27 at 14:20

Martin Prikryl

100k2525 gold badges210210 silver badges437437 bronze badges

asked Mar 27 at 13:23

Dev.7arooneyDev.7arooney

8911 silver badge1111 bronze badges

add a comment | 

I am trying to set connection to data base as I have FTP IP,User,Password and FTP Link on file zilla in python using some libraries in pandas as I have an error in problems error

Unable to import 'MySQLdb'pylint(import-error)[2,1]

and this terminal error

During handling of the above exception, another exception occurred:

Traceback (most recent call last):
File "c:/Users/user 3/Desktop/My Python Refrence/ImpDataToMySQL.py", line 
8, in <module>
engine = create_engine('sqlite:///:memory:', echo=True)
File "C:Anacondalibsite-packagessqlalchemyengine__init__.py", line 
425, in create_engine
return strategy.create(*args, **kwargs)
File "C:Anacondalibsite-packagessqlalchemyenginestrategies.py", line 
81, in create
dbapi = dialect_cls.dbapi(**dbapi_args)
File "C:Anacondalibsite- 
packagessqlalchemydialectssqlitepysqlite.py", line 339, in dbapi
raise e
File "C:Anacondalibsite- 
packagessqlalchemydialectssqlitepysqlite.py", line 337, in dbapi
from sqlite3 import dbapi2 as sqlite # try 2.5+ stdlib name.
File "C:Anacondalibsqlite3__init__.py", line 23, in <module>
from sqlite3.dbapi2 import *
File "C:Anacondalibsqlite3dbapi2.py", line 27, in <module>
from _sqlite3 import *
ImportError: DLL load failed: The specified module could not be found.

as I found the error in this line

engine = create_engine('sqlite:///:memory:', echo=True)

I noticed that there's a concept for using this engine connection but I don't know how

As I have Details for connection like this

FTP IP : 10.xx.xx.x
User : xxxxxxx
Password : xxxxxxxx
FTP link on file zilla : /export/home/omc/var/prs/result_file/

so I searched a solution for this case I think the solution in this document

https://docs.sqlalchemy.org/en/latest/core/connections.html

but it's complicated to understand this documentation so if any one could help me to solve this I'll be thankful

python mysql sqlalchemy ftp

share|improve this question

edited Mar 27 at 14:20

Martin Prikryl

100k2525 gold badges210210 silver badges437437 bronze badges

asked Mar 27 at 13:23

Dev.7arooneyDev.7arooney

8911 silver badge1111 bronze badges

Unable to import 'MySQLdb'pylint(import-error)[2,1]

During handling of the above exception, another exception occurred:

Traceback (most recent call last):
File "c:/Users/user 3/Desktop/My Python Refrence/ImpDataToMySQL.py", line 
8, in <module>
engine = create_engine('sqlite:///:memory:', echo=True)
File "C:Anacondalibsite-packagessqlalchemyengine__init__.py", line 
425, in create_engine
return strategy.create(*args, **kwargs)
File "C:Anacondalibsite-packagessqlalchemyenginestrategies.py", line 
81, in create
dbapi = dialect_cls.dbapi(**dbapi_args)
File "C:Anacondalibsite- 
packagessqlalchemydialectssqlitepysqlite.py", line 339, in dbapi
raise e
File "C:Anacondalibsite- 
packagessqlalchemydialectssqlitepysqlite.py", line 337, in dbapi
from sqlite3 import dbapi2 as sqlite # try 2.5+ stdlib name.
File "C:Anacondalibsqlite3__init__.py", line 23, in <module>
from sqlite3.dbapi2 import *
File "C:Anacondalibsqlite3dbapi2.py", line 27, in <module>
from _sqlite3 import *
ImportError: DLL load failed: The specified module could not be found.

engine = create_engine('sqlite:///:memory:', echo=True)

FTP IP : 10.xx.xx.x
User : xxxxxxx
Password : xxxxxxxx
FTP link on file zilla : /export/home/omc/var/prs/result_file/

share|improve this question

edited Mar 27 at 14:20

Martin Prikryl

100k2525 gold badges210210 silver badges437437 bronze badges

asked Mar 27 at 13:23

Dev.7arooneyDev.7arooney

8911 silver badge1111 bronze badges

share|improve this question

edited Mar 27 at 14:20

Martin Prikryl

100k2525 gold badges210210 silver badges437437 bronze badges

asked Mar 27 at 13:23

Dev.7arooneyDev.7arooney

8911 silver badge1111 bronze badges

edited Mar 27 at 14:20

Martin Prikryl

100k2525 gold badges210210 silver badges437437 bronze badges

edited Mar 27 at 14:20

Martin Prikryl

100k2525 gold badges210210 silver badges437437 bronze badges

asked Mar 27 at 13:23

Dev.7arooneyDev.7arooney

8911 silver badge1111 bronze badges

asked Mar 27 at 13:23

Dev.7arooneyDev.7arooney

8911 silver badge1111 bronze badges