Unable to import 'MySQLdb' pylint(import-error)python sqlite failserror: Unable to find vcvarsall.batConnecting postgresql with sqlalchemyHow do I import an SQL file using the command line in MySQL?I used sqlite + pysqlite2 + sqlalchemy. But there are some confused error. eg.undefined symbolProper connection string to pass to sqlalchemy create_engine() for mysql AWS RDSTypeError: unsupported operand type(s) for *: 'int' and 'NoneType'sqlalchemy fails to connect to ms sql serversqlalchemy showing an error related to os.getenv()Error when accessing mysql database with sqlalchemy engine

Alignement of different align environment

Quick destruction of a helium filled airship?

Tikz: The position of a label change step-wise and not in a continuous way

Heyawacky: Ace of Cups

Get file name and directory in .vimrc file

How to use the passive form to say "This flower was watered."

Trying to understand how Digital Certificates and CA are indeed secure

What are the advantages of this gold finger shape?

If I am sleeping clutching on to something, how easy is it to steal that item?

How do I answer an interview question about how to handle a hard deadline I won't be able to meet?

How does the illumination of the sky from the sun compare to that of the moon?

Unsolved Problems due to Lack of Computational Power

What should I do if actually I found a serious flaw in someone's PhD thesis and an article derived from that PhD thesis?

What if a restaurant suddenly cannot accept credit cards, and the customer has no cash?

Unconventional examples of mathematical modelling

What allows us to use imaginary numbers?

Why do aircraft leave cruising altitude long before landing just to circle?

Is the Microsoft recommendation to use C# properties applicable to game development?

What was the intention with the Commodore 128?

Is a suspension needed to do wheelies?

Subgroup generated by a subgroup and a conjugate of it

How to prevent criminal gangs from making/buying guns?

programming a recursive formula into Mathematica and find the nth position in the sequence

Do I need to start off my book by describing the character's "normal world"?



Unable to import 'MySQLdb' pylint(import-error)


python sqlite failserror: Unable to find vcvarsall.batConnecting postgresql with sqlalchemyHow do I import an SQL file using the command line in MySQL?I used sqlite + pysqlite2 + sqlalchemy. But there are some confused error. eg.undefined symbolProper connection string to pass to sqlalchemy create_engine() for mysql AWS RDSTypeError: unsupported operand type(s) for *: 'int' and 'NoneType'sqlalchemy fails to connect to ms sql serversqlalchemy showing an error related to os.getenv()Error when accessing mysql database with sqlalchemy engine






.everyoneloves__top-leaderboard:empty,.everyoneloves__mid-leaderboard:empty,.everyoneloves__bot-mid-leaderboard:empty margin-bottom:0;








1















I am trying to set connection to data base as I have FTP IP,User,Password and FTP Link on file zilla in python using some libraries in pandas as I have an error in problems error



Unable to import 'MySQLdb'pylint(import-error)[2,1]


and this terminal error



During handling of the above exception, another exception occurred:

Traceback (most recent call last):
File "c:/Users/user 3/Desktop/My Python Refrence/ImpDataToMySQL.py", line
8, in <module>
engine = create_engine('sqlite:///:memory:', echo=True)
File "C:Anacondalibsite-packagessqlalchemyengine__init__.py", line
425, in create_engine
return strategy.create(*args, **kwargs)
File "C:Anacondalibsite-packagessqlalchemyenginestrategies.py", line
81, in create
dbapi = dialect_cls.dbapi(**dbapi_args)
File "C:Anacondalibsite-
packagessqlalchemydialectssqlitepysqlite.py", line 339, in dbapi
raise e
File "C:Anacondalibsite-
packagessqlalchemydialectssqlitepysqlite.py", line 337, in dbapi
from sqlite3 import dbapi2 as sqlite # try 2.5+ stdlib name.
File "C:Anacondalibsqlite3__init__.py", line 23, in <module>
from sqlite3.dbapi2 import *
File "C:Anacondalibsqlite3dbapi2.py", line 27, in <module>
from _sqlite3 import *
ImportError: DLL load failed: The specified module could not be found.


as I found the error in this line



engine = create_engine('sqlite:///:memory:', echo=True)


I noticed that there's a concept for using this engine connection but I don't know how



As I have Details for connection like this



FTP IP : 10.xx.xx.x
User : xxxxxxx
Password : xxxxxxxx
FTP link on file zilla : /export/home/omc/var/prs/result_file/


so I searched a solution for this case I think the solution in this document



https://docs.sqlalchemy.org/en/latest/core/connections.html



but it's complicated to understand this documentation so if any one could help me to solve this I'll be thankful










share|improve this question
































    1















    I am trying to set connection to data base as I have FTP IP,User,Password and FTP Link on file zilla in python using some libraries in pandas as I have an error in problems error



    Unable to import 'MySQLdb'pylint(import-error)[2,1]


    and this terminal error



    During handling of the above exception, another exception occurred:

    Traceback (most recent call last):
    File "c:/Users/user 3/Desktop/My Python Refrence/ImpDataToMySQL.py", line
    8, in <module>
    engine = create_engine('sqlite:///:memory:', echo=True)
    File "C:Anacondalibsite-packagessqlalchemyengine__init__.py", line
    425, in create_engine
    return strategy.create(*args, **kwargs)
    File "C:Anacondalibsite-packagessqlalchemyenginestrategies.py", line
    81, in create
    dbapi = dialect_cls.dbapi(**dbapi_args)
    File "C:Anacondalibsite-
    packagessqlalchemydialectssqlitepysqlite.py", line 339, in dbapi
    raise e
    File "C:Anacondalibsite-
    packagessqlalchemydialectssqlitepysqlite.py", line 337, in dbapi
    from sqlite3 import dbapi2 as sqlite # try 2.5+ stdlib name.
    File "C:Anacondalibsqlite3__init__.py", line 23, in <module>
    from sqlite3.dbapi2 import *
    File "C:Anacondalibsqlite3dbapi2.py", line 27, in <module>
    from _sqlite3 import *
    ImportError: DLL load failed: The specified module could not be found.


    as I found the error in this line



    engine = create_engine('sqlite:///:memory:', echo=True)


    I noticed that there's a concept for using this engine connection but I don't know how



    As I have Details for connection like this



    FTP IP : 10.xx.xx.x
    User : xxxxxxx
    Password : xxxxxxxx
    FTP link on file zilla : /export/home/omc/var/prs/result_file/


    so I searched a solution for this case I think the solution in this document



    https://docs.sqlalchemy.org/en/latest/core/connections.html



    but it's complicated to understand this documentation so if any one could help me to solve this I'll be thankful










    share|improve this question




























      1












      1








      1


      1






      I am trying to set connection to data base as I have FTP IP,User,Password and FTP Link on file zilla in python using some libraries in pandas as I have an error in problems error



      Unable to import 'MySQLdb'pylint(import-error)[2,1]


      and this terminal error



      During handling of the above exception, another exception occurred:

      Traceback (most recent call last):
      File "c:/Users/user 3/Desktop/My Python Refrence/ImpDataToMySQL.py", line
      8, in <module>
      engine = create_engine('sqlite:///:memory:', echo=True)
      File "C:Anacondalibsite-packagessqlalchemyengine__init__.py", line
      425, in create_engine
      return strategy.create(*args, **kwargs)
      File "C:Anacondalibsite-packagessqlalchemyenginestrategies.py", line
      81, in create
      dbapi = dialect_cls.dbapi(**dbapi_args)
      File "C:Anacondalibsite-
      packagessqlalchemydialectssqlitepysqlite.py", line 339, in dbapi
      raise e
      File "C:Anacondalibsite-
      packagessqlalchemydialectssqlitepysqlite.py", line 337, in dbapi
      from sqlite3 import dbapi2 as sqlite # try 2.5+ stdlib name.
      File "C:Anacondalibsqlite3__init__.py", line 23, in <module>
      from sqlite3.dbapi2 import *
      File "C:Anacondalibsqlite3dbapi2.py", line 27, in <module>
      from _sqlite3 import *
      ImportError: DLL load failed: The specified module could not be found.


      as I found the error in this line



      engine = create_engine('sqlite:///:memory:', echo=True)


      I noticed that there's a concept for using this engine connection but I don't know how



      As I have Details for connection like this



      FTP IP : 10.xx.xx.x
      User : xxxxxxx
      Password : xxxxxxxx
      FTP link on file zilla : /export/home/omc/var/prs/result_file/


      so I searched a solution for this case I think the solution in this document



      https://docs.sqlalchemy.org/en/latest/core/connections.html



      but it's complicated to understand this documentation so if any one could help me to solve this I'll be thankful










      share|improve this question
















      I am trying to set connection to data base as I have FTP IP,User,Password and FTP Link on file zilla in python using some libraries in pandas as I have an error in problems error



      Unable to import 'MySQLdb'pylint(import-error)[2,1]


      and this terminal error



      During handling of the above exception, another exception occurred:

      Traceback (most recent call last):
      File "c:/Users/user 3/Desktop/My Python Refrence/ImpDataToMySQL.py", line
      8, in <module>
      engine = create_engine('sqlite:///:memory:', echo=True)
      File "C:Anacondalibsite-packagessqlalchemyengine__init__.py", line
      425, in create_engine
      return strategy.create(*args, **kwargs)
      File "C:Anacondalibsite-packagessqlalchemyenginestrategies.py", line
      81, in create
      dbapi = dialect_cls.dbapi(**dbapi_args)
      File "C:Anacondalibsite-
      packagessqlalchemydialectssqlitepysqlite.py", line 339, in dbapi
      raise e
      File "C:Anacondalibsite-
      packagessqlalchemydialectssqlitepysqlite.py", line 337, in dbapi
      from sqlite3 import dbapi2 as sqlite # try 2.5+ stdlib name.
      File "C:Anacondalibsqlite3__init__.py", line 23, in <module>
      from sqlite3.dbapi2 import *
      File "C:Anacondalibsqlite3dbapi2.py", line 27, in <module>
      from _sqlite3 import *
      ImportError: DLL load failed: The specified module could not be found.


      as I found the error in this line



      engine = create_engine('sqlite:///:memory:', echo=True)


      I noticed that there's a concept for using this engine connection but I don't know how



      As I have Details for connection like this



      FTP IP : 10.xx.xx.x
      User : xxxxxxx
      Password : xxxxxxxx
      FTP link on file zilla : /export/home/omc/var/prs/result_file/


      so I searched a solution for this case I think the solution in this document



      https://docs.sqlalchemy.org/en/latest/core/connections.html



      but it's complicated to understand this documentation so if any one could help me to solve this I'll be thankful







      python mysql sqlalchemy ftp






      share|improve this question















      share|improve this question













      share|improve this question




      share|improve this question








      edited Mar 27 at 14:20









      Martin Prikryl

      100k25 gold badges210 silver badges437 bronze badges




      100k25 gold badges210 silver badges437 bronze badges










      asked Mar 27 at 13:23









      Dev.7arooneyDev.7arooney

      891 silver badge11 bronze badges




      891 silver badge11 bronze badges

























          0






          active

          oldest

          votes










          Your Answer






          StackExchange.ifUsing("editor", function ()
          StackExchange.using("externalEditor", function ()
          StackExchange.using("snippets", function ()
          StackExchange.snippets.init();
          );
          );
          , "code-snippets");

          StackExchange.ready(function()
          var channelOptions =
          tags: "".split(" "),
          id: "1"
          ;
          initTagRenderer("".split(" "), "".split(" "), channelOptions);

          StackExchange.using("externalEditor", function()
          // Have to fire editor after snippets, if snippets enabled
          if (StackExchange.settings.snippets.snippetsEnabled)
          StackExchange.using("snippets", function()
          createEditor();
          );

          else
          createEditor();

          );

          function createEditor()
          StackExchange.prepareEditor(
          heartbeatType: 'answer',
          autoActivateHeartbeat: false,
          convertImagesToLinks: true,
          noModals: true,
          showLowRepImageUploadWarning: true,
          reputationToPostImages: 10,
          bindNavPrevention: true,
          postfix: "",
          imageUploader:
          brandingHtml: "Powered by u003ca class="icon-imgur-white" href="https://imgur.com/"u003eu003c/au003e",
          contentPolicyHtml: "User contributions licensed under u003ca href="https://creativecommons.org/licenses/by-sa/3.0/"u003ecc by-sa 3.0 with attribution requiredu003c/au003e u003ca href="https://stackoverflow.com/legal/content-policy"u003e(content policy)u003c/au003e",
          allowUrls: true
          ,
          onDemand: true,
          discardSelector: ".discard-answer"
          ,immediatelyShowMarkdownHelp:true
          );



          );













          draft saved

          draft discarded


















          StackExchange.ready(
          function ()
          StackExchange.openid.initPostLogin('.new-post-login', 'https%3a%2f%2fstackoverflow.com%2fquestions%2f55378294%2funable-to-import-mysqldb-pylintimport-error%23new-answer', 'question_page');

          );

          Post as a guest















          Required, but never shown

























          0






          active

          oldest

          votes








          0






          active

          oldest

          votes









          active

          oldest

          votes






          active

          oldest

          votes




          Is this question similar to what you get asked at work? Learn more about asking and sharing private information with your coworkers using Stack Overflow for Teams.







          Is this question similar to what you get asked at work? Learn more about asking and sharing private information with your coworkers using Stack Overflow for Teams.



















          draft saved

          draft discarded
















































          Thanks for contributing an answer to Stack Overflow!


          • Please be sure to answer the question. Provide details and share your research!

          But avoid


          • Asking for help, clarification, or responding to other answers.

          • Making statements based on opinion; back them up with references or personal experience.

          To learn more, see our tips on writing great answers.




          draft saved


          draft discarded














          StackExchange.ready(
          function ()
          StackExchange.openid.initPostLogin('.new-post-login', 'https%3a%2f%2fstackoverflow.com%2fquestions%2f55378294%2funable-to-import-mysqldb-pylintimport-error%23new-answer', 'question_page');

          );

          Post as a guest















          Required, but never shown





















































          Required, but never shown














          Required, but never shown












          Required, but never shown







          Required, but never shown

































          Required, but never shown














          Required, but never shown












          Required, but never shown







          Required, but never shown







          Popular posts from this blog

          SQL error code 1064 with creating Laravel foreign keysForeign key constraints: When to use ON UPDATE and ON DELETEDropping column with foreign key Laravel error: General error: 1025 Error on renameLaravel SQL Can't create tableLaravel Migration foreign key errorLaravel php artisan migrate:refresh giving a syntax errorSQLSTATE[42S01]: Base table or view already exists or Base table or view already exists: 1050 Tableerror in migrating laravel file to xampp serverSyntax error or access violation: 1064:syntax to use near 'unsigned not null, modelName varchar(191) not null, title varchar(191) not nLaravel cannot create new table field in mysqlLaravel 5.7:Last migration creates table but is not registered in the migration table

          용인 삼성생명 블루밍스 목차 통계 역대 감독 선수단 응원단 경기장 같이 보기 외부 링크 둘러보기 메뉴samsungblueminx.comeh선수 명단용인 삼성생명 블루밍스용인 삼성생명 블루밍스ehsamsungblueminx.comeheheheh

          위키백과:대문 둘러보기 메뉴기부 안내모바일판 대문크리에이티브 커먼즈 저작자표시-동일조건변경허락 3.0CebuanoDeutschEnglishEspañolFrançaisItaliano日本語NederlandsPolskiPortuguêsРусскийSvenskaTiếng ViệtWinaray中文العربيةCatalàفارسیSrpskiУкраїнськаБългарскиНохчийнČeštinaDanskEsperantoEuskaraSuomiעבריתMagyarՀայերենBahasa IndonesiaҚазақшаBaso MinangkabauBahasa MelayuBân-lâm-gúNorskRomânăSrpskohrvatskiSlovenčinaTürkçe